
RCSB Protein Data Bank
FreeSearch and download biomolecular structures efficiently.
Free · Opens the source repo
What RCSB Protein Data Bank does
The RCSB Protein Data Bank skill provides a robust interface for searching and downloading experimentally-determined 3D structures of biomolecules, including proteins, nucleic acids, and bound ligands. This skill is particularly useful for researchers and developers working in biochemistry, structural biology, and related fields who need to access and analyze biomolecular data. By leveraging the provided scripts, users can perform searches based on various attributes such as sequence similarity, structure similarity, and chemical properties, ensuring a comprehensive exploration of the data.
To use the skill effectively, users must first set up the necessary prerequisites, including the uv skill, which facilitates the execution of the provided scripts. The core functionality revolves around fetching relevant schemas to identify searchable attributes and composing JSON queries to retrieve data from the Protein Data Bank (PDB). This structured approach allows for precise searches, whether users are looking for specific entities, instances, or assemblies.
The skill emphasizes the importance of adhering to API rate limits and redirecting outputs to files for efficient data handling. Users are guided through the process of querying the PDB, with detailed explanations provided for each query to enhance understanding and facilitate corrections if necessary. This focus on clarity makes the skill accessible to users with varying levels of expertise.
In summary, the RCSB Protein Data Bank skill is an essential tool for anyone needing to interact with biomolecular structural data, providing a streamlined workflow for searching, downloading, and analyzing PDB entries.
When to use it
Use this skill when you need to retrieve structural data for biomolecules efficiently, especially when working on research projects or applications in structural biology.
When not to use it
This skill may not be suitable for users who require real-time interactive querying or those who prefer a graphical interface for data exploration.
What you can build with it
Finding Non-Human Proteins
Use the skill to search for non-human protein structures published in specific journals, filtering results by publication date.
Searching by Chemical Components
Retrieve structures that contain specific chemical components, such as ions or small molecules, using targeted queries.
Counting Structural Features
Quickly count the number of entries with specific structural features, like disulfide bonds, to aid in your research.
How to install RCSB Protein Data Bank
View source1. Install with the skills CLI
npx skills add google-deepmind/science-skills/pdb_database --agent claude-code2. Or install it manually
Download the skill folder and drop it into ~/.claude/skills/ for all projects, or .claude/skills/ to scope it to one repo. Restart Claude Code so it picks up the new skill.
Anthropic's agentic coding CLI, and the reference implementation of Agent Skills. Drop a skill folder into ~/.claude/skills and Claude Code loads it automatically whenever a task matches the skill's description. Claude Code docs
Inside SKILL.md
Written by google-deepmindRCSB Protein Data Bank skill
Prerequisites
uv: Read theuvskill and follow its Setup instructions to ensureuvis installed and on PATH.- User Notification: If .licenses/pdb_database_LICENSE.txt does not already exist in the workspace root directory then (1) prominently notify the user to check the terms at https://www.rcsb.org/pages/usage-policy, then (2) create the file recording the notification text and timestamp.
Core Rules
- Always prefer to use the provided scripts. Only as a last resort use
curl,urllib, raw HTTP requests, or any other method to access PDB APIs. The scripts automatically enforce required rate limits. - Always redirect output to a file. Parse output with e.g.
jq,grep, or a short Python snippet. Do NOT print large API responses to stdout to avoid truncation. - Notification: If this skill is used, ensure this is mentioned in the output.
- Explain your queries On completing a task that used PDB JSON/GraphQL queries, explain in clear language what your query did so the user can correct any bad assumptions.
Attribute-based search workflow
-
Fetch the relevant schema to discover searchable attribute names. For structure attributes:
uv run scripts/fetch_schema.py --api search_structure --output schema_structure.txtFor chemical attributes:uv run scripts/fetch_schema.py --api search_chemical --output schema_chemical.txt -
Grep the schema to find relevant attributes. Grep one keyword at a time and examine many lines — there are lots of similar attributes and you must choose the best match for the user's intent.
-
Compose and run a JSON search query using the discovered attributes:
uv run scripts/search_pdb.py --query '<JSON>' --return_type <RETURN_TYPE> --output results.jsonPass the--count_onlyflag to get just the number of matching entries.
For step 2: some basic PDB concepts (helpful for attribute choice)
- Entity: A unique molecule found in a structure.
- Instance / Chain: A particular copy of an entity. E.g. if a structure contains two protein chains with the same sequence, they are the same entity but different instances / chains.
- Assembly: A biologically relevant collection of instances / chains. This may be the same as the deposited structure, a subset, or multiple copies.
- Label vs Auth: Polymer instances get letter labels ("A", "B", "AA") and their monomers are numbered. There are author-assigned ("auth") and PDB-internal ("label") schemes. The label scheme is more consistent and is always used in scripts and APIs. However, users and papers may refer to the author scheme (clarify which scheme is being used if necessary).
- Chemical component: A small molecule / monomer, with an ID matching
[A-Z]{1,3} - Primary citation: The main publication about a structure. Prefer
primary_citationattributes overcitationattributes. - Resolution: Frequently used measure of structure quality (lower is
better). Usually prefer
rcsb_entry_info.resolution_combined, which accounts for different experimental methods.
For step 3: Example queries
# Non-human proteins published in Nature, newest first
uv run scripts/search_pdb.py --query '{ "type": "group", "logical_operator": "and", "nodes": [ { "type": "terminal", "service": "text", "parameters": { "operator": "exact_match", "negation": true, "value": "Homo sapiens", "attribute": "rcsb_entity_source_organism.taxonomy_lineage.name" } }, { "type": "terminal", "service": "text", "parameters": { "operator": "exact_match", "value": "Nature", "attribute": "rcsb_primary_citation.rcsb_journal_abbrev" } } ] }' --return_type entry --sort_by rcsb_accession_info.initial_release_date --sort_direction desc --page_start 0 --rows 100 --output results.json
# Structures containing the chemical component CA (Ca2+ ion)
uv run scripts/search_pdb.py --query '{ "type": "terminal", "service": "text_chem", "parameters": { "operator": "exact_match", "value": "CA", "attribute": "rcsb_chem_comp_container_identifiers.comp_id" } }' --return_type entry --output results.json
# Number of entries with disulfide bonds
uv run scripts/search_pdb.py --query '{ "type": "terminal", "service": "text", "parameters": { "operator": "exact_match", "value": "disulfide bridge", "attribute": "rcsb_polymer_struct_conn.connect_type" } }' --return_type entry --count-only --output count.json
Common operators: exact_match, equals, exists, contains_phrase,
contains_words, in, greater, less
Similarity-based search workflow
Similarity searches do not require a schema fetch. Basic examples:
# Sequence similarity
uv run scripts/search_pdb.py --query '{ "query": { "type": "terminal", "service": "sequence", "parameters": { "evalue_cutoff": 1, "identity_cutoff": 0.9, "sequence_type": "protein", "value": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQ" } }, "request_options": { "scoring_strategy": "sequence" } }' --return_type polymer_entity --output results.json
# Structure similarity
uv run scripts/search_pdb.py --query '{ "type": "terminal", "service": "structure", "parameters": { "value": {"entry_id": "6LU7", "asym_id": "A"}, "number_of_candidates": 2000 } }' --return_type polymer_entity --output results.json
# Sequence motif match
uv run scripts/search_pdb.py --query '{ "type": "terminal", "service": "seqmotif", "parameters": { "value": "C-x(2,4)-C-x(3)-[LIVMFYWC]-x(8)-H-x(3,5)-H.", "pattern_type": "prosite", "sequence_type": "protein" } }' --return_type polymer_entity --output results.json
# Chemical descriptor match
uv run scripts/search_pdb.py --query '{ "type": "terminal", "service": "chemical", "parameters": { "value": "InChI=1S/C8H9NO2/c1-6(10)9-7-2-4-8(11)5-3-7/h2-5,11H,1H3,(H,9,10)", "type": "descriptor", "descriptor_type": "InChI", "match_type": "graph-strict" } }' --return_type mol_definition --output results.json
See https://search.rcsb.org/#search-services for more details.
Full text search workflow
Searches all text associated with an entry. Example:
uv run scripts/search_pdb.py --query '{ "type": "terminal", "service": "full_text", "parameters": { "value": "isopeptide + ( collagen | fibrinogen )" } }' --return_type entry --output results.json
Important: use
full_textsearch as a last resort when there's no more precise attribute search available. Consider using thestruct.titleorrcsb_pubmed_abstract_textattributes instead.
File download workflow
To download full PDB entries, use the download_coordinate_files.py script. Use
this when you need access to atomic coordinates, when asked for a pdb / mmcif
file, or when non-specifically asked to fetch a PDB code. Example:
uv run scripts/download_coordinate_files.py --ids "4HHB,6BEA" --format "mmcif" --output_dir <OUTPUT_DIR>
Metadata query workflow
This flow is significantly more efficient than downloading full coordinate files when you only need a few pieces of metadata about each entry / entity.
-
Fetch the schema for the relevant object type. E.g.
uv run scripts/fetch_schema.py --api data_entry --output schema_entry.txt -
Grep the schema for relevant fields (one keyword at a time, many lines).
-
Compose and run a GraphQL metadata query:
uv run scripts/fetch_pdb_metadata.py --query '<GraphQL>' --output results.json
For step 3: Example queries
# Fetch structure titles and experimental methods
uv run scripts/fetch_pdb_metadata.py --query '{ entries(entry_ids: ["1STP", "2JEF", "1CDG"]) { rcsb_id struct { title } exptl { method } } }' --output results.json
# Fetch polymer entity taxonomy and cluster membership
uv run scripts/fetch_pdb_metadata.py --query '{ polymer_entities(entity_ids:["2CPK_1","3WHM_1","2D5Z_1"]) { rcsb_id rcsb_entity_source_organism { ncbi_taxonomy_id ncbi_scientific_name } rcsb_cluster_membership { cluster_id identity } } }' --output results.json
# Fetch polymer entity external sequence database accessions
uv run scripts/fetch_pdb_metadata.py --query '{ entries(entry_ids:["7NHM", "5L2G"]){ polymer_entities { rcsb_id rcsb_polymer_entity_container_identifiers { reference_sequence_identifiers { database_accession database_name } } } } }' --output results.json
Frequently asked questions about RCSB Protein Data Bank
Similar skills
Deep Research
Conduct comprehensive, cited research across multiple sources.
Exa Search
Neural search for web, code, and company research.
Market Research
Conduct thorough market and competitive analysis with source attribution.
arXiv Research
Easily search and retrieve academic papers from arXiv.
Drug Discovery
Streamline your pharmaceutical research and analysis.
Research Paper Writing
Streamline your ML research paper process from start to finish.
